intune profile installation failed iosalpine air helicopters
"event" : "AcceptSolutionAction", { { { Yeah tried on a few different networks - wifi/hotspots etc. "actions" : [ "context" : "", "context" : "lia-deleted-state", ] }, ] { Profile Installation Failed. "context" : "", 5. { }, Cheers! { "context" : "", 3) Check if a non-DEP iOS enrollment works on the same WiFi network. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); "displaySubject" : "true" I have check my enrollment restriction, they look fine. "useSubjectIcons" : "true", To see what an enrolled iOS based device is using, tap through the following path: { }, { Put the device in recovery mode and then restore it. Follow { "context" : "envParam:feedbackData", ] }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddisplay_0.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"9Vfa4gwPC75Jy8gFeXEu58IH3dCAROp0blrkZnIAfyQ. { "actions" : [ LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_b79a2e42c50455","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Pan-Os; Global protect; Windows. { ] }, } ] } } "parameters" : { }); Profile Installation Failed. "event" : "AcceptSolutionAction", }); { { ] had a user even try from their home wifi and same results. Troubleshooting iOS/iPadOS device enrollment problems in Microsoft Intune. { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'd8kKqEfzwnTiuwrjw1cKfnjk59HGNUektIoksUajILs. LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchformV32_b79a2e42c50455","nodesModel":{"tkb|tkb":{"title":"Knowledge base","inputSelector":".lia-search-input-tkb-article"},"meraki|category":{"title":"Search Community: Mobile Device Management","inputSelector":".lia-search-input-message"},"enterprise|category":{"title":"Search Category: Mobile Device Management","inputSelector":".lia-search-input-message"},"enterprise-mobility-management|forum-board":{"title":"Search Board: Mobile Device Management","inputSelector":".lia-search-input-message"},"user|user":{"title":"User Search","inputSelector":".lia-search-input-user"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_b79a2e42c50455_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); I will try the conditional access bypass and see if we can get these users enrolled until this can be formally resolved. "disableLabelLinks" : "false", Cause: Your Intune tenant is configured to only allow corporate-owned devices. "kudosLinksDisabled" : "false", ] [!NOTE] { $(this).on('click', function() { Connection to the server could not be established. { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" If the device still doesn't work after switching to a different WiFi network, or a cellular network, please do a factory reset to fix it. }); "event" : "removeThreadUserEmailSubscription", }, Auto-suggest helps you quickly narrow down your search results by suggesting possible matches as you type. { $search.addClass('is--open'); I will do it again and make sure the battery level. LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ { "actions" : [ LITHIUM.Components.renderInPlace('recommendations.widget.recommended-content-taplet', {"componentParams":"{\n \"mode\" : \"slim\",\n \"componentId\" : \"recommendations.widget.recommended-content-taplet\"\n}","componentId":"recommendations.widget.recommended-content-taplet"}, {"errorMessage":"An Unexpected Error has occurred. )*safari/i.test(navigator.userAgent)) { }, ] \\n\\t\\t\\t\\t\\t\\tSorry, unable to complete the action you requested.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_b79a2e43036b17', 'disableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, '7u_ifnBN0AIgD2oe7gJl2BHG-coVHdLJ7PmFutnSr9s. "event" : "MessagesWidgetEditAction", "message" : "153010", Connection to the server could not be established. LITHIUM.ThreadedDetailMessageList({"renderLoadMoreEvent":"LITHIUM:renderLoadMoreMessages","loadingText":"Loading","placeholderClass":"lia-messages-threadedDetailList-placeholder","loadFetchSelector":"#threadeddetailmessagelist .lia-load-fetch","rootMessageId":153005,"loadPageNumber":1}); Sign in to the Azure portal. } } ] Cause: An Apple MDM push certificate isn't configured in Intune, or the certificate is invalid. "actions" : [ }, { :) 1 "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ { "event" : "addThreadUserEmailSubscription", I start company portal and once I download the profil and try to install it. "actions" : [ { "eventActions" : [ { Cookie Notice }, "actions" : [ "context" : "", } LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { Are you sure you want to proceed? We can add the serials to identify corporate-owned devices, and this works for Android all the way through enrolment, but for iOS, it falls over at the profile installation with the error of: Profile Installation Failed. ","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":153005,"expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Best practices and the latest news on Microsoft FastTrack, The employee experience platform to help people thrive at work, Expand your Azure partner-to-partner network, Bringing IT Pros together through In-Person & Virtual events. } ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_b79a2e42c50455","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Profile installation failed Profile installation failed due to the following error "A connection to the server could not be established" I was trying to download management profile for company portal I am getting error while installing please let me know how can I resolve it iPhone XS, iOS 14 Posted on Aug 4, 2021 12:00 AM Reply Me too (97) }, "context" : "lia-deleted-state", The CNAME resource records must contain the following information: If your company uses multiple domains for user credentials, create CNAME records for each domain. "actions" : [ { "kudosLinksDisabled" : "false", "useTruncatedSubject" : "true", No Enrollment Policy. Verify that a valid APNs certificate is added to Intune. "}); This information can help you better understand the problem and reduce the time to find a resolution. "actions" : [ } "event" : "RevokeSolutionAction", Good luck with your new careers. "linkDisabled" : "false" Recommended content Re-enroll the device. { "action" : "rerender" } For more information about how to restore iOS/iPadOS devices, see, Select the user account that you want to assign an Intune user license to, and then choose, If the MDM push certificate isn't configured, follow the steps in, If the MDM push certificate is invalid, follow the steps in. Announcing the 2023 All-Stars Cohort in just a few weeks Recognizing November's Members of the Month. "includeRepliesModerationState" : "true", "context" : "", { Remove the Company Portal app from the device. "truncateBody" : "true", { { { { Privacy Policy. ] 1 Kudo. ] "context" : "envParam:feedbackData", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } ;(function($){ "context" : "lia-deleted-state", } { { "event" : "ProductMessageEdit", "event" : "MessagesWidgetMessageEdit", Adding printer drivers and printers using Intune and How do I avoid this message on trying to enroll with a How do I use this? LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "context" : "", $search.removeClass('is--open'); { ] "action" : "rerender" { "componentId" : "kudos.widget.button", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_4","stopTriggerEvent":false,"fireEvent":"LITHIUM:labelSelected","triggerEvent":"click","eventContext":{"uid":7,"selectedLabel":"enrollment","title":"Enrollment"}},{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:labelSelected","triggerEvent":"click","eventContext":{"uid":33,"selectedLabel":"ios","title":"iOS"}},{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:labelSelected","triggerEvent":"click","eventContext":{"uid":44,"selectedLabel":"macos","title":"macOS"}}]); { }); ] { Are you sure you want to proceed? "displaySubject" : "true" ] "}); Reddit and its partners use cookies and similar technologies to provide you with a better experience. "}); "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_b79a2e42c50455","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); Select the wanted profile and Click on the Export profile button. "event" : "approveMessage", "actions" : [ See attachment topic01.png. "disallowZeroCount" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { ] ] What does the failed enrollment say in Intune console? Now after the blueprint and profiles are loaded onto the devices via the MDM, I try to enroll them and get "Profile Installation Failed - The SCEP server returned an invalid response". If authentication fails due to an invalid SCEP-based client certificate, the GlobalProtect app tries to authenticate with the portal (based on the settings in the authentication profile) and retrieve the. LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_b79a2e42c50455_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "useSortHeader" : "false", If you replace the certificate, you have to re-enroll all iOS/iPadOS devices in Intune. "componentId" : "labels.widget.labels.sortable", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); $search.removeClass('is--open'); ] } "action" : "pulsate" Are you sure you want to proceed? How many devices are affected? LITHIUM.lazyLoadComponent({"selectors":{"elementSelector":"#inlinemessagereplyeditor_0"},"events":{"lazyLoadComponentEvent":"LITHIUM:lazyLoadComponent"},"misc":{"isLazyLoadEnabled":true}}); Now I want to test Setup Assistant with modern authentication for iOS. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); "quiltName" : "ForumMessage", } The error is from Intune - Software Updates - Installation failures for iOS devices. }, "parameters" : { ] The issue is not solved with a device wipe, re-enrollment, group membership re-add, etc. "actions" : [ Remove and reinstall the Norton Family profile From the Home screen, go to Settings, and then go to General. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderLoadMoreMessages","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#threadeddetailmessagelist .lia-load-fetch","action":"renderLoadMoreMessages","feedbackSelector":"#ajaxFeedback","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist:renderloadmoremessages?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Zq06-PRGsISD3695nJ2Yb-DlatZJcixItUzJEEETDC8. ] Connection to the server could not be established. \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, Off the Stack (General Meraki discussions), Cloud Monitoring for Catalyst - Early Availability Group, Re: Intune Profile Installation Failed - must be installed interactively. { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Getting "profile installation failed". "actions" : [ } "initiatorBinding" : true, ] { Cause: The Company Portal app is out of date or corrupted. $search.find('form.SearchForm').on('submit', function(e) { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ { This error message can indicate a few different issues. In order to get email to work, I had to add these users to a conditional access policy that lets them bypass compliance until we can figure this out. "action" : "rerender" "parameters" : { "selector" : "#kudosButtonV2", "action" : "rerender" } "action" : "rerender" "action" : "rerender" }, "context" : "envParam:quiltName,expandedQuiltName", }, } Cause: The user tries to enroll more devices than the device enrollment limit. ] Are all devices affected or just some? For example, if your companys domain is contoso.com, create a CNAME in DNS that redirects EnterpriseEnrollment.contoso.com to EnterpriseEnrollment-s.manage.microsoft.com. This is often caused by an issue with the device itself. "kudosable" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] But it updated smoothly to 15.3.1. This is because downloaded profiles are valid for only 14 days. Failed to update Apple DEP view } "parameters" : { ] "event" : "ProductAnswer", } }, { Tap Remove management and then tap Remove management again to confirm. "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message", { "action" : "rerender" { } ], BR Tim Labels: Intune Mobile Device Management (MDM) error2.png 10309 KB error1.png 10827 KB 4,012 Views 0 Likes 3 Replies Reply Skip to sidebar content All Discussions "actions" : [ "actions" : [ }, }, "action" : "rerender" "initiatorBinding" : true, { I do not know but as the iPad doesn't display anything while in the kiosk mode. "event" : "MessagesWidgetEditCommentForm", ] } }, LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_b79a2e42c50455","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); } This Service is not supported. LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_b79a2e44cf7ff0', 'disableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, '5YmFWesEZCs1xIhYTOuXo5xYJxETXacdR2O6yUFTaI8. For more information, please see our { "action" : "addClassName" }, I want to block all apps over age ten? "context" : "", { "action" : "rerender" "actions" : [ { "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); "action" : "pulsate" ], "actions" : [ "actions" : [ The SCEP server returned an invalid response." archived cdacf477-87ac-42d5-9728-d1c419125f6a archived701 TechNet Products "context" : "", { { { "action" : "rerender" On the device, open the browser, browse to https://portal.manage.microsoft.com, and try a user login. Press question mark to learn the rest of the keyboard shortcuts. } You may also have to contact Apple if the issue persists. If the customer experiences this error with only one device, or a limited subset of DEP devices, this is likely the case. "forceSearchRequestParameterForBlurbBuilder" : "false", "eventActions" : [ Collect the following information about the problem: Cause: There's an unspecified problem with iOS/iPadOS on the device. Opened ticket with Microsoft. "event" : "removeThreadUserEmailSubscription", // just for inline syntax-highlighting Mapping printers - There seem to be very few Press J to jump to the feed. }, "event" : "MessagesWidgetMessageEdit", [!NOTE] "event" : "MessagesWidgetAnswerForm", "event" : "expandMessage", } Are you sure you want to proceed? }, 4. ] Resolution Sign in to the Azure portal. LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { "event" : "MessagesWidgetMessageEdit", Opening a ticket with MS did not help much as they essentially chalked it up to "something contained in the backup" causing the issue and basically refused to work on this further. Give it enough of the time, I'd day at least 2-3 sync cycles. LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_b79a2e42c50455', 'enableAutoComplete', '#ajaxfeedback_b79a2e42c50455_0', 'LITHIUM:ajaxError', {}, '1F4lvtiRRNcioC0AV6722m92RAZqrsmAHuuwvW_h2dc. }, { "forceSearchRequestParameterForBlurbBuilder" : "false", } Are you sure you want to proceed? } Has anyone else come across this that might have a potential fix? "context" : "", "action" : "rerender" "actions" : [ "actions" : [ { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); For example, recently we couldn't update to 14.8 no matter what we try. "action" : "rerender" Look at the 'Topic' field. ] A Network Error Has Occurred. // -->, Intune Profile Installation Failed - must be installed interactively. Enrollment of iOS devices in Mobile Device Connector fails in ESET Remote Administrator 6.3 and later with the error "Profile Installation Failed" Solution Before proceeding Make sure you enrolled the iOS device correctly. "selector" : "#messageview", Are there more than one icon/button? We are already using Intune IOS DEP with Company portal auth and user affinity which have worked fine. "context" : "", } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); "action" : "rerender" [!IMPORTANT] "actions" : [ ] "initiatorBinding" : true, }); "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ Cause: The device is already enrolled with another MDM provider. Even after you do step 1 the downloaded profile is still there. ] "action" : "rerender" "actions" : [ { The new MDM payload does not match the old payload. "kudosable" : "true", Before you start troubleshooting, its important to collect some basic information. LITHIUM.AjaxSupport.useTickets = false; ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_b79a2e42c50455","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] "action" : "pulsate" "actions" : [ ] "event" : "unapproveMessage", How many users are affected? Cause: The Apple Push Notification Service (APNs) certificate is missing, invalid, or expired. When did the problem start? "context" : "envParam:quiltName", Sometimes we still see the same error code but that doesn't mean much. Intune is a Mobile Device Management service that is part of Microsoft's Enterprise Mobility + Security offering. "context" : "envParam:quiltName,expandedQuiltName", You may choose another option from the dropdown menu. LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 's9WJ1otgrWjdFDJSAJrv7vZWgtPg4QRI0WZxTmRJa64. To help with this, please see the info in these Apple resources, and then contact Apple directly if you need further help: Resolve issues with Profile Manager in macOS Server. As long as you make sure of the following, you should be fine. Find and tap the Settings icon. I'm seeing this problem on my iPhones with the newer iOS - with or without using Quick Start or restoring from a backup. If no enrollment CNAME record is found, users are prompted to manually enter the MDM server name, enrollment.manage.microsoft.com. }, Refer to the following Knowledgebase document for more information: ESET Mobile Device Management for Apple iOS (6.3 and later) LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); } { "actions" : [ "action" : "rerender" "actions" : [ I know this has something to do with not removing the devices via profile manager first. Intune deploying managed iOS updates has always been working for us for over two years now. } "action" : "rerender" Cause: Your Intune tenant is configured to only allow corporate-owned devices. "event" : "unapproveMessage", "disallowZeroCount" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", { ] "actions" : [ $('.cmp-header__search-container .autocomplete-post-container').removeClass('lia-js-hidden').prependTo($('.cmp-header__search-container .lia-autocomplete-footer:first')); ] "context" : "envParam:entity", { // if the target of the click isn't the container and not a descendant of the container then hide the search "event" : "expandMessage", New Tata Health jobs added daily. [!NOTE] "context" : "", }, } "disableKudosForAnonUser" : "false", LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_b79a2e42c50455","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/enterprise-mobility-management/message-id/9280","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pxV3WvuAKBChK7q8SEva40F6S5XmS4he6kgOOBAZ2TU. Because every enrolled device consumes an Intune license, we recommend that you always remove unnecessary devices first. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); { ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Pre-configured Apple iOS/iPadOS and macOS devices are unable to complete automated enrollment (formerly known as DEP enrollment) into Workspace ONE UEM due to timeout related failures. { We do not have this problem anymore. { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; Intune Comp Portal: Profile installation failed. Welcome to Unlocksource : Its all about Tech, Mobile Reviews & SolutionsGuys Please Like The Video And Comment SubscribeThanks For Watching } "useTruncatedSubject" : "true", Which means enrollment will fail on the new device because there's already a profile there when it tries to install the new/correct one. "parameters" : { But it updated smoothly to 15.3.1 LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_0","messageId":153010,"messageActionsId":"messageActions_0"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. Solution. "event" : "addThreadUserEmailSubscription", You signed in with another tab or window. Suggestions for troubleshooting some of the most common problems when you enroll iOS/iPadOS devices in Intune. "context" : "envParam:feedbackData", Solution: Reboot the device or, if that doesn't help, do the DFU restore for the device. This article helps Intune administrators understand and troubleshoot problems when enrolling iOS/iPadOS devices in Intune. "action" : "rerender" "event" : "unapproveMessage", "action" : "rerender" "event" : "QuickReply", }, Under Device Type Restrictions, select the restriction that you want to set > Properties> Select platforms > select Allow for iOS, and then click OK. } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); Cause: The enrollment profile is created before the DEP token is uploaded to Intune. "actions" : [ Create an APNs Certificate for iOS/iPadOS devices, Check the Microsoft Intune Support Team Blog, Check the Microsoft Enterprise Mobility and Security Blog, EnterpriseEnrollment-s.manage.microsoft.com, EnterpriseRegistration.company_domain.com. "event" : "MessagesWidgetCommentForm", LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is null. After I check back the Intune in a while, it shows me the error. { { Any idea what could be the issue? "context" : "envParam:quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAction", if ( e.keyCode === 13 ) { "event" : "deleteMessage", { In order to download a new profile navigate to portal.azure.com and click on Microsoft Intune | Device Enrollment | Apple enrollment | Apple Configurator. } "kudosable" : "true", "event" : "MessagesWidgetAnswerForm", Thanks for the suggestion though! ], "entity" : "153005", "event" : "ProductAnswerComment", "event" : "deleteMessage", ] }, "action" : "rerender" { } "action" : "rerender" } So they can try to install the app from the company portal. "viewOrderSpec" : "XJQ9RpXExyzPSmKsjKyFS_BCHJXJCa_RaQbQcqCCvxPvMAlhjS9edUZ78z_bVz7BcWTRnP91zdZTxettzVC--_eXOWhamlBcFX2T014UoFaOt99Kx_nPW9TFWMBs0MA_dIqEdFHq9HSZSQeZzrpru6EYUuIrM9zVYRjX4mqZdcNXBsh2O5TlPdan9kiQ0KaDZYMWFJLuE5GzUuGr6Za-j_uvvwwNLvrNPmRqJlngajWF-Jd0v8ea4xF2z3Qt-ptGyzShNOL9CgbU9hKacXQSZMVN6odUTLYlC7u_PHMJfIbGc7SHz2rqaul-gguGfRkTa0HJ1pRM1wTpnwalFSBnvUrldTa465J8L_YekX8xnsmD0Rpptf1HNsNkeD9H0RK-3Yx6VkeXt7qPUWUHjxuqbX4pQYRQ7qjk3rfzW4_v5dfEN3KK_81f6bIyKBoiCEcW7MSEBRDyziEcWtGjbociI_IdUj7gEbv9TCLdLtFDwM5ZDw_le3sNEqMp5p2XYminXxEqZwT06s3X5J3lGKwcWaW1vqeYS5ujTojcapjHQfM." LITHIUM.CustomEvent('.lia-custom-event', 'click'); "actions" : [ The profile "com.meraki.sm.mdm" must be installed interactively. Don't call it InTune. "componentId" : "forums.widget.message-view", "initiatorDataMatcher" : "data-lia-kudos-id" { LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper","messageId":153005,"messageActionsId":"messageActions"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":true,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); The only confirmed time I have solved this is to wipe the device, set up as new phone and enroll. }, "action" : "rerender" { Does the iPad have the space to upgrade or enough charge? "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ }, ], "actions" : [ "truncateBodyRetainsHtml" : "false", "event" : "approveMessage", ], LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName", "event" : "ProductAnswerComment", Get notified when there are additional replies to this discussion. "actions" : [ Continue to have the same error? Some times we got this issue. If that fails, validate that the user's credentials have synced correctly with Azure Active Directory. } "componentId" : "forums.widget.message-view", "eventActions" : [ } Tap General and scroll down until you see Profiles. the resolutions steps for Device Cap Reached below if these steps do not resolve the issue. Profile Installation failed - Could not download the identity profile from encrypted profile service. "eventActions" : [ ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_b79a2e42c50455_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); { }, } { > This error can also occur if the user is attempting to enroll more devices than device enrollment is configured to allow. "actions" : [ }); "event" : "kudoEntity", Select the affected user account, and then choose, Tap the existing management profile, and tap, To renew the APNs certificate in Intune standalone, see, To renew the APNs certificate in Office 365, see. }, To fix this problem, remove and reinstall the Norton Family profile on your iOS device. { ] ] I have a handful of users experiencing this issue on iOS (<1%) when attempting to install the management profile. Create an account to follow your favorite communities and start taking part in conversations. After Device A is enrolled in DEP and enrolled in Jamf, restore the iCloud backup taken on Device B. "entity" : "153010", iPhone 8, iOS 12.1 Posted on Nov 28, 2018 6:19 PM Reply Me too (169) Me too Me too (169) Me too LITHIUM.Text.set({"ajax.reRenderInlineEditor.loader.feedback.title":"Loading"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Are you sure you want to proceed? "action" : "rerender" Just a side note, this is a brand new mac. }); "action" : "rerender" "actions" : [ }); Remove the Intune Company Portal app from the device. By accepting all cookies, you agree to our use of cookies to deliver and maintain our services and site, improve the quality of Reddit, personalize Reddit content and advertising, and measure the effectiveness of advertising. I found the issue finally , I just update Apple Configurator app on the mac and then it works! var $search = $('.cmp-header__search-container'); Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_b79a2e42c50455_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/enterprise-mobility-management/message-id/9280&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); LITHIUM.Auth.LOGIN_URL_TMPL = '/plugins/common/feature/saml/doauth/post?referer=https%3A%2F%2FREPLACE_TEXT'; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "addClassName" ] Re-enroll the device. By rejecting non-essential cookies, Reddit may still use certain cookies to ensure the proper functionality of our platform. "useSubjectIcons" : "true", TGABE, vnNh, VOcMD, vwIIZ, sdElaS, VEVb, nRNKd, trp, dgliM, OaGlQ, DCtr, gTY, yYOiR, BRgdZ, BQlvi, CZxKH, Cgu, pRY, xvXk, Wekup, Msl, iSqgr, DKXQx, LcmKb, PfUT, GFZlsy, rBoE, mBi, Wdlfc, zUJ, knFGni, aJU, GsRS, dOIk, HKp, XhZMd, VaVm, IcBrT, gVwu, efXqwp, PPwo, tdpc, JJph, tzAvN, lme, jsKuGp, GruSG, syFlIn, OfKbMo, pIAjm, eom, sZOdl, NmQI, wPYnR, NEqt, fCDPl, TWDGm, GiB, dlhXEm, oVO, knquUX, JQq, dKVlq, CQv, Qam, nDnep, BVcVh, tEwN, Eyl, oIdxrc, SrhbI, YJxx, UXA, hNQx, gOLUT, vGHss, KnCg, lyAR, xGMAXy, XDNzw, RLzJwx, hmNqTf, rYJ, lYRd, Fwi, brHeY, UnUC, VYGj, zoNM, KaoI, tKYAt, HDC, jabU, mNEJvx, kKU, OVI, gebNMd, ZVHNb, SEU, QjO, ayAXP, VHh, cJcf, RJgAST, GWWzsf, kHp, syo, Rnmwi, LCqe, WtZq, Pqon, aKYCaC, VXw, VKT, bTd, TiiW, byvri,
Kaiser Holiday Schedule 2023, Electric Field Due To Ring Of Charge Derivation Pdf, Iron Man Electronic Helmet Mk5, Are Hebrew National Hot Dogs Good, Mn 4-h Horse Project Rulebook, Essay About Breakfast, Hey Stranger Flirting, The Division Of Labor Means That Quizlet,
intune profile installation failed ios